Commit 82b23a36 authored by Lingling Jin (lij313)'s avatar Lingling Jin (lij313)
Browse files

files for lab final

parent 972b1bab
>P001 interesting new protein
MSGLQLIWKSPTQLVLFVLLITISCIDLCHAVGAATPTKKSPPVRITKPQPVSSTTTAIP
TTNEGSTTGEQLALLVSSTTEGTASSASSSSNGGSDDSSSTTAAGSLVPEICITGLQLSF
TNADGEQVVRKQQELVQVIEGDVMLSVITSDPVSALFVINRVNQANLISADFEVGIRAIN
VDNASLAENLLIQEVQYLQQCTQYSMGIFIDFDLYKRLESIIRDLEYNVWPIPSARAHLF
PKVAHLLHQMPWGEKIASVEIVTETLDIYNEFMDAARQEHMCLMHFKSDDNVYILFGNKM
ANHFKENGTVFAVPTERTEHIFLEELPNKSFILMENGIELRTADLDPMPTTLDEVLIGKS
VLPSRILVFASPIVDLMNWLRGSLAKHCKRDEDLYMLESCFNFLNFIEDWRTPEYRRTHD
TAELLSLLRMRKLSTSMLFQMYQKKQETVDVITGESRMELREIASQNFVTNVTTYYHYNR
DNHTSLELKTKFGLVFNCQFTAGENRRYPFLFDGESVMFWRIKLDTWVATGLTAAILGLI
ATLAILVFIVVRISLGDVFEGNPVTSILLLLSLILVFCSFVPFSMEYVGEQRNSHVTFED
VHTLNTLCGVRVFIMTLVYCFVFSLLLCRAVMLASIGSEGGFLSHVNGYIQAIICVLSVF
VQVGMSVQLLVVMHLASESVSCENIYYGRWLWGLLAYDFLLLCSLVSLVPFIYRSQRNYR
EGILIVIGAVLILIIWSVWIALSMFGDEWRDAAIPLGMQASGWAVLVGILIPRTFLIVRG
IERSDIAQALPSLTSLAFAQNNQYSSEQSVYECVNPAMRHCSQEEMNHQSPSEIPTLPLR
GGGPRRQQFFANLRQANANINPQRPPPHPQQSPSRSSVCSXPPSXXHXKIXRF
n-mer seq n-mer pos
LLSPR sp|P26664|POLG_HCV1 95
LLSPR sp|P26664|POLG_HCV1 1150
LLLLL sp|P26664|POLG_HCV1 795
LLLLL sp|P26664|POLG_HCV1 794
LLLLA sp|P26664|POLG_HCV1 796
LLLLA sp|P26664|POLG_HCV1 2994
n-mer seq n-mer pos
LLLLL tr|Q9WIK8|Q9WIK8_9HEPC 796
LLLLL tr|Q9WIK8|Q9WIK8_9HEPC 797
LLLLL tr|Q9WIK8|Q9WIK8_9HEPC 798
NTLTC tr|Q9WIK8|Q9WIK8_9HEPC 2710
NTLTC tr|Q9WIK8|Q9WIK8_9HEPC 577
LLALL tr|Q9WIK8|Q9WIK8_9HEPC 1152
LLALL tr|Q9WIK8|Q9WIK8_9HEPC 97
LLALL tr|Q9WIK8|Q9WIK8_9HEPC 891
LLALL tr|Q9WIK8|Q9WIK8_9HEPC 537
AAEAA tr|Q9WIK8|Q9WIK8_9HEPC 1742
AAEAA tr|Q9WIK8|Q9WIK8_9HEPC 743
n-mer seq n-mer pos
Supports Markdown
0% or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment