Commit 669d66ee authored by Lingling Jin (lij313)'s avatar Lingling Jin (lij313)
Browse files

update lab final file

parent 82b23a36
>P001 interesting new protein
MSGLQLIWKSPTQLVLFVLLITISCIDLCHAVGAATPTKKSPPVRITKPQPVSSTTTAIP
TTNEGSTTGEQLALLVSSTTEGTASSASSSSNGGSDDSSSTTAAGSLVPEICITGLQLSF
TNADGEQVVRKQQELVQVIEGDVMLSVITSDPVSALFVINRVNQANLISADFEVGIRAIN
VDNASLAENLLIQEVQYLQQCTQYSMGIFIDFDLYKRLESIIRDLEYNVWPIPSARAHLF
PKVAHLLHQMPWGEKIASVEIVTETLDIYNEFMDAARQEHMCLMHFKSDDNVYILFGNKM
ANHFKENGTVFAVPTERTEHIFLEELPNKSFILMENGIELRTADLDPMPTTLDEVLIGKS
VLPSRILVFASPIVDLMNWLRGSLAKHCKRDEDLYMLESCFNFLNFIEDWRTPEYRRTHD
TAELLSLLRMRKLSTSMLFQMYQKKQETVDVITGESRMELREIASQNFVTNVTTYYHYNR
DNHTSLELKTKFGLVFNCQFTAGENRRYPFLFDGESVMFWRIKLDTWVATGLTAAILGLI
ATLAILVFIVVRISLGDVFEGNPVTSILLLLSLILVFCSFVPFSMEYVGEQRNSHVTFED
VHTLNTLCGVRVFIMTLVYCFVFSLLLCRAVMLASIGSEGGFLSHVNGYIQAIICVLSVF
VQVGMSVQLLVVMHLASESVSCENIYYGRWLWGLLAYDFLLLCSLVSLVPFIYRSQRNYR
EGILIVIGAVLILIIWSVWIALSMFGDEWRDAAIPLGMQASGWAVLVGILIPRTFLIVRG
IERSDIAQALPSLTSLAFAQNNQYSSEQSVYECVNPAMRHCSQEEMNHQSPSEIPTLPLR
GGGPRRQQFFANLRQANANINPQRPPPHPQQSPSRSSVCSXPPSXXHXKIXRF
Supports Markdown
0% or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment