Commit 10c7596b authored by Lingling Jin (lij313)'s avatar Lingling Jin (lij313)
Browse files

update biopython

parent cd090cee
......@@ -15,7 +15,3 @@ bash-4.4$
bash-4.4$ ./biopython4.py
bash-4.4$
bash-4.4$ ls -l output.fasta
-rw-r--r-- 1 kusalik faculty 101 Jan 31 19:30 output.fasta
bash-4.4$
>biopython_example_4 sequence in biopython example 4
AAPRTVYAFSARPLAGGEPFNLSSLRGKVLLIENVASLUGTTVRDYTQMNDLQRRLG
Supports Markdown
0% or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment